MTCH1 Rabbit Polyclonal Antibody

SKU TA341931

Rabbit Polyclonal Anti-MTCH1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTCH1 antibody: synthetic peptide directed towards the C terminal of human MTCH1. Synthetic peptide located within the following region: NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: mitochondrial carrier 1
• Database Link:
  NP_055156
  Q9NZJ7
• Background: This gene encodes a member ofThe mitochondrial carrier family.The encoded protein is localized toThe mitochondrion inner membrane and induces apoptosis independent ofThe proapoptotic proteins Bax and Bak. Pseudogenes on chromosomes 6 and 11 have been identified forThis gene. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Oct 2012]
• Synonyms: CGI-64; PIG60; PSAP; SLC25A49
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane