ASTN2 Rabbit Polyclonal Antibody

SKU TA341927

Rabbit Polyclonal Anti-ASTN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASTN2 antibody: synthetic peptide directed towards the N terminal of human ASTN2. Synthetic peptide located within the following region: LLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADISLVHWRQQWLENG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 142 kDa
• Gene Name: astrotactin 2
• Database Link:
  NP_054729
  O75129
• Background: This gene encodes a protein that is expressed inThe brain and may function in neuronal migration, based on functional studies ofThe related astrotactin 1 gene in human and mouse. A deletion atThis locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found forThis locus. [provided by RefSeq, May 2010]
• Synonyms: bA67K19.1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane