OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ST6GALNAC6 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341921
Rabbit Polyclonal Anti-ST6GALNAC6 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "ST6GALNAC6 or NM_013443" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC6. Synthetic peptide located within the following region: YHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Database Link
Background ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides onThe cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 PubMed 12668675). supplied by OMIM, Mar 2008. Transcript Variant:This variant (5) differs inThe 5' UTR, lacks a portion ofThe 5' coding region, and initiates translation from a downstream in-frame start codon, compared to variant 1.The encoded isoform (c) is shorter atThe N-terminus, compared to isoform a. Variants 3, 4 and 5 all encode isoform c. ##Evidence-Data-START## Transcript exon combination :: AK057100.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025087 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms SIAT7-F; SIAT7F; ST6GALNACVI
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - ganglio series, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products