C20orf103 (LAMP5) Rabbit Polyclonal Antibody

SKU TA341902

Rabbit Polyclonal Anti-C20orf103 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C20orf103 antibody: synthetic peptide directed towards the middle region of human C20orf103. Synthetic peptide located within the following region: CQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDERE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: lysosomal associated membrane protein family member 5
• Database Link:
  NP_036393
  Q9UJQ1
• Background: The exact function of C20orf103 remains unknown.
• Synonyms: BAD-LAMP; BADLAMP; C20orf103; LAMP-5; UNC-43
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 82%

Reference Data

• Protein Families: Transmembrane