CHIC2 Rabbit Polyclonal Antibody

SKU TA341896

Rabbit Polyclonal Anti-CHIC2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: cysteine rich hydrophobic domain 2
• Database Link:
  NP_036242
  Q9UKJ5
• Background: This gene encodes a member ofThe CHIC family of proteins.The encoded protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures andThe plasma membrane.This gene is associated with some cases of acute myeloid leukemia. [provided by RefSeq, Jul 2008]
• Synonyms: BTL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane