BACE2 Rabbit Polyclonal Antibody

SKU TA341894

Rabbit Polyclonal Anti-BACE2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: beta-site APP-cleaving enzyme 2
• Database Link:
  NP_620477
  Q9Y5Z0
• Background: This gene encodes an integral membrane glycoprotein that functions as an aspartic protease.The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step inThe etiology of Alzheimer's disease and Down syndrome.The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Synonyms: AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane
• Protein Pathways: Alzheimer's disease