ATP1B4 Rabbit Polyclonal Antibody

CAT#: TA341890

Rabbit Polyclonal Anti-ATP1B4 Antibody

Product Images

WB Suggested Anti-ATP1B4 Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ATP1B4 antibody: synthetic peptide directed towards the middle region of human ATP1B4. Synthetic peptide located within the following region: ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: ATPase Na+/K+ transporting family member beta 4
• Database Link:
  NP_036201
  Entrez Gene 23439 Human
  UniProt ID Q9UN42
• Background: This gene has been found in all vertebrate genomes sequenced to date. However,This gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species,This gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals,The encoded protein interacts withThe nuclear transcriptional coregulator SKIP and may be involved inThe regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Mar 2010]
• Synonyms: (Na+); ATPase; beta 4 polypeptide; K+ transporting; K-ATPase beta-m subunit; OTTHUMP00000023940; X
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cardiac muscle contraction