HYPE (FICD) Rabbit Polyclonal Antibody

SKU TA341882

Rabbit Polyclonal Anti-FICD Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FICD antibody: synthetic peptide directed towards the C terminal of human FICD. Synthetic peptide located within the following region: GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: FIC domain containing
• Database Link:
  NP_009007
  Q9BVA6
• Background: The function remains known.
• Synonyms: HIP13; HYPE; UNQ3041
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane