Germany
Japan
United Kingdom
China
BTN2A1 Rabbit Polyclonal Antibody
Product Images
USD 200.00
USD 867.00
USD 436.00
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-BTN2A1 antibody: synthetic peptide directed towards the N terminal of human BTN2A1. Synthetic peptide located within the following region: SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 57 kDa |
| Gene Name | butyrophilin subfamily 2 member A1 |
| Database Link | |
| Background | This gene encodes a member ofThe immunoglobulin superfamily.The gene is located in a cluster of butyrophilin-like genes inThe juxta-telomeric region ofThe major histocompatibility complex on chromosome 6. A pseudogene ofThis gene has been identified inThis cluster.The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations inThis gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2013] |
| Synonyms | BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Guinea pig: 86%; Horse: 82% |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
Be the first one to submit a review
