BTN2A1 Rabbit Polyclonal Antibody

SKU TA341878

Rabbit Polyclonal Anti-BTN2A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTN2A1 antibody: synthetic peptide directed towards the N terminal of human BTN2A1. Synthetic peptide located within the following region: SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: butyrophilin subfamily 2 member A1
• Database Link:
  NP_008980
  Q7KYR7
• Background: This gene encodes a member ofThe immunoglobulin superfamily.The gene is located in a cluster of butyrophilin-like genes inThe juxta-telomeric region ofThe major histocompatibility complex on chromosome 6. A pseudogene ofThis gene has been identified inThis cluster.The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations inThis gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2013]
• Synonyms: BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Guinea pig: 86%; Horse: 82%

Reference Data

• Protein Families: Druggable Genome, Transmembrane