BTN2A1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-BTN2A1 antibody: synthetic peptide directed towards the N terminal of human BTN2A1. Synthetic peptide located within the following region: SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 57 kDa |
| Gene Name | butyrophilin subfamily 2 member A1 |
| Database Link | |
| Background | This gene encodes a member ofThe immunoglobulin superfamily.The gene is located in a cluster of butyrophilin-like genes inThe juxta-telomeric region ofThe major histocompatibility complex on chromosome 6. A pseudogene ofThis gene has been identified inThis cluster.The encoded protein is an integral plasma membrane protein involved in lipid, fatty-acid, and sterol metabolism. Alterations inThis gene may be associated with several disease states including metabolic syndrome. Multiple alternatively spliced transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Jul 2013 |
| Synonyms | BK14H9.1; BT2.1; BTF1; BTN2.1; DJ3E1.1 |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 91%; Mouse: 91%; Dog: 86%; Guinea pig: 86%; Horse: 82% |
| Reference Data | |
| Protein Categories | Cytokines, Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
