Nogo A (RTN4) Rabbit Polyclonal Antibody

SKU TA341874

Rabbit Polyclonal Anti-RTN4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RTN4 antibody: synthetic peptide directed towards the middle region of human RTN4. Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: reticulon 4
• Database Link:
  NP_997403
  Q9NQC3
• Background: This gene belongs toThe family of reticulon encoding genes. Reticulons are associated withThe endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.The product ofThis gene is a potent neurite outgrowth inhibitor which may also help blockThe regeneration ofThe central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
• Synonyms: 250; ASY; Nbla00271; Nbla10545; NI220; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane