PGRMC1 Rabbit Polyclonal Antibody

SKU TA341853

Rabbit Polyclonal Anti-PGRMC1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: progesterone receptor membrane component 1
• Database Link:
  NP_006658
  O00264
• Background: This gene encodes a putative membrane-associated progesterone steroid receptor.The protein is expressed predominantly inThe liver and kidney. [provided by RefSeq, Mar 2010]
• Synonyms: HPR6.6; MPR
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transmembrane