ERLIN1 Rabbit Polyclonal Antibody

SKU TA341840

Rabbit Polyclonal Anti-ERLIN1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERLIN1 antibody: synthetic peptide directed towards the N terminal of human ERLIN1. Synthetic peptide located within the following region: KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: ER lipid raft associated 1
• Database Link:
  NP_006450
  O75477
• Background: Erlin-1 belongs toThe band 7/mec-2 family. Erlin-1 and erlin-2 are novel members ofThe prohibitin family of proteins that define lipid-raft-like domains ofThe ER.
• Synonyms: C10orf69; Erlin-1; KE04; KEO4; SPFH1; SPG62
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%; Bovine: 92%

Reference Data

• Protein Families: Transmembrane