ERLIN1 Rabbit Polyclonal Antibody

SKU
TA341840
Rabbit Polyclonal Anti-ERLIN1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ERLIN1 antibody: synthetic peptide directed towards the N terminal of human ERLIN1. Synthetic peptide located within the following region: KNVPCGTSGGVMIYIDRIEVVNMLAPYAVFDIVRNYTADYDKTLIFNKIH
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name ER lipid raft associated 1
Database Link
Background Erlin-1 belongs toThe band 7/mec-2 family. Erlin-1 and erlin-2 are novel members ofThe prohibitin family of proteins that define lipid-raft-like domains ofThe ER.
Synonyms C10orf69; Erlin-1; KE04; KEO4; SPFH1; SPG62
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 92%; Bovine: 92%
Reference Data
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ERLIN1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.