TAL2 Rabbit Polyclonal Antibody

SKU TA341815

Rabbit Polyclonal Anti-Tal2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tal2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: T-cell acute lymphocytic leukemia 2
• Database Link:
  NP_005412
  Q16559
• Background: The function ofThis protein remains unknown.
• Synonyms: bHLHa19; T-cell acute lymphocytic leukemia 2
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 93%; Bovine: 93%; Dog: 86%; Horse: 79%; Rabbit: 77%

Reference Data

• Protein Families: Druggable Genome