Foxd1 Rabbit Polyclonal Antibody

SKU TA341773

Rabbit Polyclonal Anti-FOXD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXD1 antibody: synthetic peptide directed towards the N terminal of mouse FOXD1. Synthetic peptide located within the following region: TGAGTGGGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISSRFP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: forkhead box D1
• Database Link:
  NP_032268
  Q61345
• Background: FOXD1 belongs toThe forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXD1, specifically activateThe 1b promoter ofThe RI alpha gene in testicular Sertoli cells.
• Synonyms: FKHL8; FREAC-4; FREAC4
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 81%

Reference Data