Dlx4 Rabbit Polyclonal Antibody

SKU TA341752

Rabbit Polyclonal Anti-Dlx4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dlx4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: distal-less homeobox 4
• Database Link:
  NP_031893
  P70436
• Background: May play a role in determiningThe production of hemoglobin S. May act as a repressor.
• Synonyms: BP1; DLX-7; DLX-8; DLX7; DLX8; DLX9
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 92%; Horse: 86%; Guinea pig: 86%

Reference Data