NOTO Rabbit Polyclonal Antibody

SKU TA341740

Rabbit Polyclonal Anti-Noto Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Noto antibody: synthetic peptide directed towards the n terminal of mouse Noto. Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 26 kDa
• Gene Name: notochord homeobox
• Database Link:
  NP_001127934
  A8MTQ0
• Background: Noto is a transcription regulator acting downstream of both FOXA2 and T during notochord development.Noto is required for node morphogenesis.Noto is essential for cilia formation inThe posterior notochord (PNC) and for left-right patterning; acts upstream of FOXJ1 and RFX3 inThis process and is required forThe expression of various components important for axonemal assembly and function. Plays a role in regulating axial versus paraxial cell fate.
• Synonyms: Noto
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Guinea pig: 93%; Rabbit: 92%; Bovine: 86%; Dog: 85%

Reference Data