KCNK6 Rabbit Polyclonal Antibody

SKU
TA341716
Rabbit Polyclonal Anti-KCNK6 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name potassium two pore domain channel subfamily K member 6
Database Link
Background This gene encodes one ofThe members ofThe superfamily of potassium channel proteins containing two pore-forming P domains.This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. provided by RefSeq, Jul 2008
Synonyms K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.