MCM9 Rabbit Polyclonal Antibody

SKU TA341692

Rabbit Polyclonal Anti-MCM9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM9 antibody: synthetic peptide directed towards the N terminal of human MCM9. Synthetic peptide located within the following region: NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: minichromosome maintenance 9 homologous recombination repair factor
• Database Link:
  NP_694987
  Q9NXL9
• Background: The protein encoded byThis gene is a member ofThe mini-chromosome maintenance (MCM) protein family that are essential forThe initiation of eukaryotic genome replication. Binding ofThis protein to chromatin has been shown to be a pre-requisite for recruitingThe MCM2-7 helicase to DNA replication origins.This protein also binds, and is a positive regulator of,The chromatin licensing and DNA replication factor 1, CDT1. [provided by RefSeq, Nov 2010]
• Synonyms: C6orf61; dJ329L24.1; dJ329L24.3; MCMDC1; ODG4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 86%

Reference Data