MCM4 Rabbit Polyclonal Antibody

SKU TA341684

Rabbit Polyclonal Anti-MCM4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 95 kDa
• Gene Name: minichromosome maintenance complex component 4
• Database Link:
  NP_005905
  P33991
• Background: The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.The phosphorylation ofThis protein by CDC2 kinase reducesThe DNA helicase activity and chromatin binding ofThe MCM complex.This gene is mapped to a region onThe chromosome 8 head-to-head next toThe PRKDC/DNA-PK, a DNA-activated protein kinase involved inThe repair of DNA double-strand breaks. Alternatively spliced transcript variants encodingThe same protein have been reported. [provided by RefSeq, Jul 2008]
• Synonyms: CDC21; CDC54; hCdc21; NKCD; NKGCD; P1-CDC21
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Cell cycle, DNA replication