GJC1 (GJD3) Rabbit Polyclonal Antibody

SKU TA341675

Rabbit Polyclonal Anti-GJC1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJC1 antibody: synthetic peptide directed towards the N terminal of human GJC1. Synthetic peptide located within the following region: IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: gap junction protein delta 3
• Database Link:
  NP_689343
  Q8N144
• Background: This gene is a member ofThe large family of connexins that are required forThe formation of gap junctions. Six connexin monomers form a hemichannel, or connexon, onThe cell surface.This connexon can interact with a connexon from a neighboring cell, thus forming a channel linkingThe cytoplasm ofThe 2 cells. [provided by RefSeq, Jul 2008]
• Synonyms: Cx30.2; CX31.9; GJA11; GJC1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Horse: 86%

Reference Data