GJA9 Rabbit Polyclonal Antibody

SKU TA341674

Rabbit Polyclonal Anti-GJA9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9. Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: gap junction protein alpha 9
• Database Link:
  NP_110399
  P57773
• Background: Connexins, such as GJA9, are involved inThe formation of gap junctions, intercellular conduits that directly connectThe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AL705385.1, AK312811.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: CX58; CX59; GJA10
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%

Reference Data

• Protein Families: Transmembrane