Mycbp Rabbit Polyclonal Antibody

SKU TA341668

Rabbit Polyclonal Anti-Mycbp Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mycbp antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mycbp. Synthetic peptide located within the following region: HLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: MYC binding protein
• Database Link:
  NP_062634
  Q9EQS3
• Background: May controlThe transcriptional activity of MYC. StimulatesThe activation of E box-dependent transcription by MYC.
• Synonyms: AMY-1; AMY1; FLJ41056
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data