GJA5 Rabbit Polyclonal Antibody

SKU
TA341664
Rabbit Polyclonal Anti-GJA5 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GJA5 antibody: synthetic peptide directed towards the N terminal of human GJA5. Synthetic peptide located within the following region: STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 39 kDa
Gene Name gap junction protein alpha 5
Database Link
Background This gene is a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene may be associated with atrial fibrillation. Alternatively spliced transcript variants encodingThe same isoform have been described. provided by RefSeq, Jul 2008
Synonyms ATFB11; CX40
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Rabbit: 82%; Rat: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Categories Cardiovascular diseases, Membrane Proteins
Protein Families Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.