GJB2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GJB2 antibody: synthetic peptide directed towards the N terminal of human GJB2. Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 25 kDa |
| Gene Name | gap junction protein beta 2 |
| Database Link | |
| Background | This gene encodes a member ofThe gap junction protein family.The gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells.These structures were shown to consist of cell-to-cell channels that facilitateThe transfer of ions and small molecules between cells.The gap junction proteins, also known as connexins, purified from fractions of enriched gap junctions from different tissues differ. According to sequence similarities atThe nucleotide and amino acid levels,The gap junction proteins are divided into two categories, alpha and beta. Mutations inThis gene are responsible for as much as 50% of pre-lingual, recessive deafness. provided by RefSeq, Oct 2008 |
| Synonyms | CX26; DFNA3; DFNA3A; DFNB1; DFNB1A; HID; KID; NSRD1; PPK |
| Note | Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79% |
| Reference Data | |
| Protein Categories | Membrane Proteins, Nervous system Diseases |
| Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.