GJA4 Rabbit Polyclonal Antibody

SKU TA341662

Rabbit Polyclonal Anti-GJA4 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: gap junction protein alpha 4
• Database Link:
  NP_002051
  P35212
• Background: This gene encodes a member ofThe connexin gene family.The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route forThe diffusion of low molecular weight materials from cell to cell. Mutations inThis gene have been associated with atherosclerosis and a higher risk of myocardial infarction. [provided by RefSeq, Jul 2008]
• Synonyms: CX37
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Sheep: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Horse: 79%; Mouse: 79%

Reference Data

• Protein Families: Ion Channels: Other, Transmembrane