GJB1 Rabbit Polyclonal Antibody
Product Data | |
Application | IHC, WB |
---|---|
Recommended Dilution | WB, IHC |
Reactivity | Human, Mouse |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GJB1 antibody: synthetic peptide directed towards the C terminal of human GJB1. Synthetic peptide located within the following region: GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 31 kDa |
Gene Name | gap junction protein beta 1 |
Database Link | |
Background | This gene encodes a member ofThe gap junction protein family.The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitateThe transfer of ions and small molecules between cells. According to sequence similarities atThe nucleotide and amino acid levels,The gap junction proteins are divided into two categories, alpha and beta. Mutations inThis gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encodingThe same protein have been found forThis gene. [provided by RefSeq, Oct 2008] |
Synonyms | CMTX; CMTX1; CX32 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.