beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

SKU TA341637

Rabbit Polyclonal Anti-ADRB1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: adrenoceptor beta 1
• Database Link:
  NP_000675
  P08588
• Background: The adrenergic receptors (subtypes alpha 1, alpha 2, beta 1, and beta 2) are a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors that mediateThe physiological effects ofThe hormone epinephrine andThe neurotransmitter norepinephrine. Specific polymorphisms inThis gene have been shown to affectThe resting heart rate and can be involved in heart failure. [provided by RefSeq, Jul 2008]
• Synonyms: ADRB1R; B1AR; BETA1AR; RHR
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 87%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Dilated cardiomyopathy, Endocytosis, Gap junction, Neuroactive ligand-receptor interaction