TDRD9 Rabbit Polyclonal Antibody

SKU TA341629

Rabbit Polyclonal Anti-TDRD9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TDRD9 antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD9. Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 152 kDa
• Gene Name: tudor domain containing 9
• Database Link:
  NP_694591
  Q8NDG6
• Background: Probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and preventingTheir mobilization, which is essential forThe germline integrity. Acts viaThe piRNA metabolic process, which mediatesThe repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governThe methylation and subsequent repression of transposons. Its association with PIWIL4 andThe piP-bodies suggests a participation inThe secondary piRNAs metabolic process.
• Synonyms: C14orf75; HIG-1; NET54
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 89%

Reference Data