MDA5 (IFIH1) Rabbit Polyclonal Antibody

SKU TA341618

Rabbit Polyclonal Anti-IFIH1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 117 kDa
• Gene Name: interferon induced with helicase C domain 1
• Database Link:
  NP_071451
  Q9BYX4
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with bothThese agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation inThis gene is associated with diabetes mellitus insulin-dependent type 19. [provided by RefSeq, Jul 2012]
• Synonyms: AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%; Rat: 82%; Pig: 77%; Mouse: 77%

Reference Data

• Protein Pathways: RIG-I-like receptor signaling pathway