DHX35 Rabbit Polyclonal Antibody

SKU TA341617

Rabbit Polyclonal Anti-DHX35 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHX35 antibody: synthetic peptide directed towards the N terminal of human DHX35. Synthetic peptide located within the following region: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 79 kDa
• Gene Name: DEAH-box helicase 35
• Database Link:
  NP_068750
  Q9H5Z1
• Background: DEAD box proteins characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The function ofThis gene product which is a member ofThis family, has not been determined. Alternatively spliced transcript variants have been found forThis gene. [provided by RefSeq, Jun 2010]
• Synonyms: C20orf15; DDX35; KAIA0875
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%

Reference Data