DDX28 Rabbit Polyclonal Antibody

SKU TA341607

Rabbit Polyclonal Anti-DDX28 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX28 antibody: synthetic peptide directed towards the N terminal of human DDX28. Synthetic peptide located within the following region: FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 59 kDa
• Gene Name: DEAD-box helicase 28
• Database Link:
  NP_060850
  Q9NUL7
• Background: DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is intronless. It encodes an RNA-dependent ATPase.The encoded protein is localized inThe mitochondria andThe nucleus, and can be transported betweenThe mitochondria andThe nucleus. [provided by RefSeq, Jul 2008]
• Synonyms: MDDX28
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 85%; Rat: 83%; Mouse: 83%; Bovine: 79%

Reference Data