DDX42 Rabbit Polyclonal Antibody

SKU TA341581

Rabbit Polyclonal Anti-DDX42 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 103 kDa
• Gene Name: DEAD-box helicase 42
• Database Link:
  NP_031398
  Q86XP3
• Background: This gene encodes a member ofThe Asp-Glu-Ala-Asp (DEAD) box protein family. Members ofThis protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encodingThe same protein have been identified forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: DDX42P; RHELP; RNAHP; SF3B8; SF3b125
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Spliceosome