OriGene Logo

DDX42 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341581
Rabbit Polyclonal Anti-DDX42 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY404249 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 (DDX42), transcript variant 2 100 ug
$665.00

View other "DDX42 or NM_007372" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DDX42 antibody: synthetic peptide directed towards the N terminal of human DDX42. Synthetic peptide located within the following region: PLEAFMAEVEDQAARDMKRLEEKDKERKNVKGIRDDIEEEDDQEAYFRYM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 103 kDa
Gene Name DEAD-box helicase 42
Database Link
Background This gene encodes a member ofThe Asp-Glu-Ala-Asp (DEAD) box protein family. Members ofThis protein family are putative RNA helicases, and are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Two transcript variants encodingThe same protein have been identified forThis gene. provided by RefSeq, Jul 2008
Synonyms DDX42P; RHELP; RNAHP; SF3B8; SF3b125
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Pathways Spliceosome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.