Gemin 3 (DDX20) Rabbit Polyclonal Antibody

SKU TA341580

Rabbit Polyclonal Anti-Ddx20 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ddx20 antibody is: synthetic peptide directed towards the middle region of Rat Ddx20. Synthetic peptide located within the following region: DSESESDSCSSRTSSQSKGNKSYLEGSSDTQLKDSECTSVGGPLSLEQIQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 90 kDa
• Gene Name: DEAD-box helicase 20
• Database Link:
  NP_009135
  Q9UHI6
• Background: member ofThe DEAD box family of putative RNA helicases; interacts with SF-1 and demonstrates transcriptional repression [RGD, Feb 2006]. Sequence Note:The RefSeq transcript and protein were derived from genomic sequence to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SRS388402 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: DP103; GEMIN3
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Bovine: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome