OriGene Logo

DDX39 (DDX39A) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341576
Rabbit Polyclonal Anti-DDX39 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY417057 Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 (DDX39) 100 ug
$436.00
TP301759 Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 (DDX39), 20 µg
20 ug
$737.00

View other "DDX39 or NM_005804" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DDX39 antibody: synthetic peptide directed towards the N terminal of human DDX39. Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47 kDa
Gene Name DEAD-box helicase 39A
Database Link
Background This gene encodes a member ofThe DEAD box protein family.These proteins are characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is thought to play a role inThe prognosis of patients with gastrointestinal stromal tumors. A pseudogene ofThis gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants ofThis gene have been described, butTheir full-length nature is not known. provided by RefSeq, Sep 2013
Synonyms BAT1; BAT1L; DDX39; DDXL; URH49
Note Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.