RECQL5 Rabbit Polyclonal Antibody

SKU TA341562

Rabbit Polyclonal Anti-RECQL5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RECQL5 antibody: synthetic peptide directed towards the middle region of human RECQL5. Synthetic peptide located within the following region: CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 109 kDa
• Gene Name: RecQ like helicase 5
• Database Link:
  NP_004250
  O94762
• Background: The protein encoded byThis gene is a helicase that is important for genome stability.The encoded protein also prevents aberrant homologous recombination by displacing RAD51 from ssDNA. Three transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2011]
• Synonyms: RECQ5
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%

Reference Data