OriGene Logo

RECQL5 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341562
Rabbit Polyclonal Anti-RECQL5 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY423995 Transient overexpression lysate of RecQ protein-like 5 (RECQL5), transcript variant 3 100 ug
$436.00

View other "RECQL5 or NM_004259" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RECQL5 antibody: synthetic peptide directed towards the middle region of human RECQL5. Synthetic peptide located within the following region: CDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 109 kDa
Gene Name RecQ like helicase 5
Database Link
Background The protein encoded byThis gene is a helicase that is important for genome stability.The encoded protein also prevents aberrant homologous recombination by displacing RAD51 from ssDNA. Three transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Jul 2011
Synonyms RECQ5
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 91%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.