SOHLH1 Rabbit Polyclonal Antibody

SKU TA341546

Rabbit Polyclonal Anti-SOHLH1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOHLH1 antibody: synthetic peptide directed towards the middle region of human SOHLH1. Synthetic peptide located within the following region: EAAWLEGRIRQEFDKLREFLRVEEQAILDAMAEETRQKQLLADEKMKQLT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: spermatogenesis and oogenesis specific basic helix-loop-helix 1
• Database Link:
  NP_001095147
  Q5JUK2
• Background: This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis.This gene is located on chromosome 9. Mutations inThis gene are associated with nonobstructive azoospermia. Alternatively spliced transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Aug 2013]
• Synonyms: bA100C15.3; bHLHe80; C9orf157; NOHLH; SPATA27; TEB2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data