Zinc finger protein 30 (ZNF30) Rabbit Polyclonal Antibody

SKU TA341543

Rabbit Polyclonal Anti-ZNF30 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF30 antibody: synthetic peptide directed towards the middle region of human ZNF30. Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: zinc finger protein 30
• Database Link:
  NP_919306
  P17039
• Background: May be involved in transcriptional regulation.
• Synonyms: KOX28
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 91%; Rat: 91%; Bovine: 91%; Mouse: 86%; Zebrafish: 86%; Dog: 83%; Rabbit: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Transcription Factors