Zinc finger protein 30 (ZNF30) Rabbit Polyclonal Antibody

SKU
TA341543
Rabbit Polyclonal Anti-ZNF30 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF30 antibody: synthetic peptide directed towards the middle region of human ZNF30. Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 71 kDa
Gene Name zinc finger protein 30
Database Link
Background May be involved in transcriptional regulation.
Synonyms KOX28
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 91%; Rat: 91%; Bovine: 91%; Mouse: 86%; Zebrafish: 86%; Dog: 83%; Rabbit: 83%; Guinea pig: 83%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.