Gonadotropin Inducible Transcription Repressor 1 (ZNF461) Rabbit Polyclonal Antibody

SKU TA341507

Rabbit Polyclonal Anti-GIOT Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GIOT-1 antibody: synthetic peptide directed towards the N terminal of human GIOT-1. Synthetic peptide located within the following region: QHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: zinc finger protein 461
• Database Link:
  NP_694989
  Q8TAF7
• Background: May be involved in transcriptional regulation.
• Synonyms: GIOT-1; GIOT1; HZF28
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 85%

Reference Data

• Protein Families: Transcription Factors