CBLL2 Rabbit Polyclonal Antibody

SKU TA341489

Rabbit Polyclonal Anti-ZNF645 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF645 antibody: synthetic peptide directed towards the N terminal of human ZNF645. Synthetic peptide located within the following region: MNKMPAGEQECEYNKEGKYYSKGVKLVRKKKKIPGYRWGDIKINIIGEKD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: zinc finger protein 645
• Database Link:
  NP_689790
  Q8N7E2
• Background: This gene encodes a member ofThe zinc finger domain-containing protein family.This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control. [provided by RefSeq, Aug 2011]
• Synonyms: CT138; HAKAIL
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data