CCDC16 (ZNF830) Rabbit Polyclonal Antibody

SKU TA341436

Rabbit Polyclonal Anti-ZNF830 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC16 antibody: synthetic peptide directed towards the middle region of human CCDC16. Synthetic peptide located within the following region: ENTAEALPEGFFDDPEVDARVRKVDAPKDQMDKEWDEFQKAMRQVNTISE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: zinc finger protein 830
• Database Link:
  NP_443089
  Q96NB3
• Background: May act as a regulator ofThe cell cycle in embryos by participating in control of M phase.
• Synonyms: CCDC16; OMCG1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data