OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF101 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341429
Rabbit Polyclonal Anti-ZNF101 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409627 Transient overexpression lysate of zinc finger protein 101 (ZNF101) (as WB positive control) 100 ug
$665.00

View other "ZNF101 or NM_033204" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF101 antibody: synthetic peptide directed towards the N terminal of human ZNF101. Synthetic peptide located within the following region: EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 50 kDa
Gene Name zinc finger protein 101
Database Link
Background Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions,The most important of which is regulating transcription (summary by Bellefroid et al., 1993 PubMed 8467795). See ZNF91 (MIM 603971) for general information on ZNFs. supplied by OMIM, Nov 2010. Transcript Variant:This variant (2) differs inThe 5' UTR, lacks a portion ofThe 5' coding region and initiates translation at a downstream start codon, compared to variant 1. It encodes isoform 2, which has a shorter N-terminus, compared to isoform 1. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB264378.1, BI838075.1 ECO:0000332 ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms HZF12
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products