ZNF101 Rabbit Polyclonal Antibody

SKU TA341429

Rabbit Polyclonal Anti-ZNF101 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF101 antibody: synthetic peptide directed towards the N terminal of human ZNF101. Synthetic peptide located within the following region: EWALLSPSQKNLYRDVTLETFRNLASVGIQWKDQDIENLYQNLGIKLRSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: zinc finger protein 101
• Database Link:
  NP_149981
  Q8IZC7
• Background: Zinc finger proteins (ZNFs), such as ZNF101, bind nucleic acids and perform many key functions,The most important of which is regulating transcription (summary by Bellefroid et al., 1993 [PubMed 8467795]). See ZNF91 (MIM 603971) for general information on ZNFs. [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (2) differs inThe 5' UTR, lacks a portion ofThe 5' coding region and initiates translation at a downstream start codon, compared to variant 1. It encodes isoform 2, which has a shorter N-terminus, compared to isoform 1. Sequence Note:This RefSeq record was created from transcript and genomic sequence data to makeThe sequence consistent withThe reference genome assembly.The genomic coordinates used forThe transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: DB264378.1, BI838075.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
• Synonyms: HZF12
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors