ZNF397 Rabbit Polyclonal Antibody

SKU TA341412

Rabbit Polyclonal Anti-ZNF397 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF397 antibody: synthetic peptide directed towards the middle region of human ZNF397. Synthetic peptide located within the following region: VQQHNPESGEEAVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRAS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: zinc finger protein 397
• Database Link:
  NP_001128650
  Q8NF99
• Background: This gene encodes a protein with a N-terminal SCAN domain, andThe longer isoform contains nine C2H2-type zinc finger repeats inThe C-terminal domain.The protein localizes to centromeres during interphase and early prophase, and different isoforms can repress or activate transcription in transfection studies. Multiple transcript variants encoding different isoforms have been found forThis gene. Additional variants have been described, butTheir biological validity has not been determined. [provided by RefSeq, Oct 2009]
• Synonyms: ZNF47; ZSCAN15
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Dog: 75%

Reference Data

• Protein Families: Transcription Factors