OriGene Logo

OMA1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA340395
Rabbit Polyclonal Anti-OMA1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "OMA1 or NM_145243" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Fish, Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 60
Gene Name OMA1 zinc metallopeptidase
Database Link
Background OMA1 is a mitochondrial protease.
Synonyms 2010001O09Rik; DAB1; MPRP-1; peptidase; YKR087C; ZMPOMA1
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Bovine: 85%; Zebrafish: 85%; Yeast: 83%; Guinea pig: 79%
Reference Data
Protein Categories Enzyme: Peptidases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protease, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.