OMA1 Rabbit Polyclonal Antibody

SKU TA340395

Rabbit Polyclonal Anti-OMA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Fish, Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60
• Gene Name: OMA1 zinc metallopeptidase
• Database Link:
  NP_660286
  Q96E52
• Background: OMA1 is a mitochondrial protease.
• Synonyms: 2010001O09Rik; DAB1; MPRP-1; peptidase; YKR087C; ZMPOMA1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Rabbit: 86%; Bovine: 85%; Zebrafish: 85%; Yeast: 83%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane