SPPL3 Rabbit Polyclonal Antibody

SKU TA340322

Rabbit Polyclonal Anti-SPPL3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SPPL3 antibody: synthetic peptide directed towards the middle region of human SPPL3. Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: signal peptide peptidase like 3
• Database Link:
  NP_620584
  Q8TCT6
• Background: SPPL3 may act as intramembrane protease.
• Synonyms: IMP2; MDHV1887; PRO4332; PSH1; PSL4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Protease, Transmembrane