C2orf65 (M1AP) Rabbit Polyclonal Antibody

SKU TA340316

Rabbit Polyclonal Anti-M1AP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-M1AP antibody is: synthetic peptide directed towards the middle region of HUMAN M1AP. Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: meiosis 1 associated protein
• Database Link:
  NP_001268224
  Q8TC57
• Background: This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms.
• Synonyms: C2orf65; D6Mm5e; SPATA37
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Pig: 79%

Reference Data