C14orf148 (NOXRED1) Rabbit Polyclonal Antibody

SKU TA340305

Rabbit Polyclonal Anti-NOXRED1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NOXRED1 antibody: synthetic peptide directed towards the middle region of human NOXRED1. Synthetic peptide located within the following region: KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: NADP-dependent oxidoreductase domain containing 1
• Database Link:
  NP_001106946
  Q6NXP6
• Background: The function of this protein remains unknown.
• Synonyms: C14orf148
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 85%; Bovine: 85%; Pig: 77%; Guinea pig: 77%

Reference Data