GPRASP2 Rabbit Polyclonal Antibody

SKU TA340292

Rabbit Polyclonal Anti-GPRASP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPRASP2 antibody: synthetic peptide directed towards the middle region of human GPRASP2. Synthetic peptide located within the following region: EQESLLQPDQPSPEFTFQYDPSYRSVREIREHLRARESAESESWSCSCIQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 94 kDa
• Gene Name: G protein-coupled receptor associated sorting protein 2
• Database Link:
  NP_612446
  Q96D09
• Background: The exact function of FAM14A remains unknown.
• Synonyms: GASP2
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 91%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome